Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLIC2 Peptide - N-terminal region

CLIC2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CLIC2

UniProt

O15247

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLIC2 Rabbit Polyclonal Antibody (orb588234) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001280

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Gre mLin-02/GREM2 Polyclonal Antibody
PAV7750 100 μL

Rabbit Anti-Gre mLin-02/GREM2 Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-S6K1 (Ser424) Rabbit pAb, 1 pack = 100 µL
BAL2520 1 Each

Phospho-S6K1 (Ser424) Rabbit pAb, 1 pack = 100 µL

Sign In for Pricing
View Details
SPINK5
404738-01 50 µL

SPINK5

Sign In for Pricing
View Details
SPINK5
404738-02 100 µL

SPINK5

Sign In for Pricing
View Details
Hypoxia Inducible Factor 1 Alpha (HIF1a) Antibody
abx025300 100 µL

Hypoxia Inducible Factor 1 Alpha (HIF1a) Antibody

Sign In for Pricing
View Details
Mouse Emc7 Pre-designed siRNA Set B
SI104261B 1 Each

Mouse Emc7 Pre-designed siRNA Set B

Sign In for Pricing
View Details