Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLIC2 Peptide - N-terminal region

CLIC2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CLIC2

UniProt

O15247

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLIC2 Rabbit Polyclonal Antibody (orb588234) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001280

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal IDH3G Antibody
NBP1-85824 0.1 mL

Rabbit Polyclonal IDH3G Antibody

Sign In for Pricing
View Details
Gelsolin Conjugated Antibody
MBS9453061-01 0.1 mL (AF350)

Gelsolin Conjugated Antibody

Sign In for Pricing
View Details
Gelsolin Conjugated Antibody
MBS9453061-02 0.1 mL (AF405)

Gelsolin Conjugated Antibody

Sign In for Pricing
View Details
Gelsolin Conjugated Antibody
MBS9453061-03 0.1 mL (AF488)

Gelsolin Conjugated Antibody

Sign In for Pricing
View Details
Gelsolin Conjugated Antibody
MBS9453061-04 0.1 mL (AF555)

Gelsolin Conjugated Antibody

Sign In for Pricing
View Details
Gelsolin Conjugated Antibody
MBS9453061-05 0.1 mL (Biotin)

Gelsolin Conjugated Antibody

Sign In for Pricing
View Details