Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLIC3 Peptide - middle region

CLIC3 Peptide - middle region

Product Specifications

Product Name Alternative

CLIC3

UniProt

O95833

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLIC3 Rabbit Polyclonal Antibody (orb331479) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004660

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Reep4 Mouse shRNA Plasmid (Locus ID 72549)
TL504745 1 Kit

Reep4 Mouse shRNA Plasmid (Locus ID 72549)

Sign In for Pricing
View Details
TLR5 (NM_003268) Human Tagged ORF Clone Lentiviral Particle
RC215293L4V 200 µL

TLR5 (NM_003268) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Bovine Arf GAP with SH3 domain, ANK repeat and PH domain containing protein 1 (ASAP1) ELISA kit
GTR10450340 96 Well

Bovine Arf GAP with SH3 domain, ANK repeat and PH domain containing protein 1 (ASAP1) ELISA kit

Sign In for Pricing
View Details
PCMV-PPL-P2A-mCherry-Neo Plasmid
PVT76098 2 µg

PCMV-PPL-P2A-mCherry-Neo Plasmid

Sign In for Pricing
View Details
GM14295 Adenovirus (Mouse)
21836054 1.0 mL

GM14295 Adenovirus (Mouse)

Sign In for Pricing
View Details
Methyl 5-nitro-1H-pyrrole-3-carboxylate
HBA11627-01 50 mg

Methyl 5-nitro-1H-pyrrole-3-carboxylate

Sign In for Pricing
View Details