Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLIC3 Peptide - middle region

CLIC3 Peptide - middle region

Product Specifications

Product Name Alternative

CLIC3

UniProt

O95833

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLIC3 Rabbit Polyclonal Antibody (orb331479) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004660

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(1R) -1- (1,3-benzodioxol-5-yl) ethanamine
sc-345334A 5 g

(1R) -1- (1,3-benzodioxol-5-yl) ethanamine

Sign In for Pricing
View Details
5T4 Rabbit Monoclonal Antibody
AF1624 50 µL

5T4 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Vernakalant Hcl
RM-V050100-01 10 mg

Vernakalant Hcl

Sign In for Pricing
View Details
Vernakalant Hcl
RM-V050100-02 25 mg

Vernakalant Hcl

Sign In for Pricing
View Details
Vernakalant Hcl
RM-V050100-03 50 mg

Vernakalant Hcl

Sign In for Pricing
View Details
Vernakalant Hcl
RM-V050100-04 100 mg

Vernakalant Hcl

Sign In for Pricing
View Details