Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CtBP1 Peptide - C-terminal region

CtBP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CTBP1, CTBP

UniProt

Q13363

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CtBP1 Rabbit Polyclonal Antibody (orb588239) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-NXPH3 Antibody Picoband®, iFluor647 Conjugate
A14597-3-iFluor647 100 µg

Anti-NXPH3 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
Mouse Monoclonal anti-human ERK1
hAP-0725 50 µg

Mouse Monoclonal anti-human ERK1

Sign In for Pricing
View Details
Aplyronine C
orb1941788-01 5 mg

Aplyronine C

Sign In for Pricing
View Details
Aplyronine C
orb1941788-02 50 mg

Aplyronine C

Sign In for Pricing
View Details
Anti-ATP5G3 Rabbit pAb
GB113340-100 100 μL

Anti-ATP5G3 Rabbit pAb

Sign In for Pricing
View Details
Car4 (NM_007607) Mouse Tagged Lenti ORF Clone
MR204282L4 10 µg

Car4 (NM_007607) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details