Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CtBP1 Peptide - C-terminal region

CtBP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CTBP1, CTBP

UniProt

Q13363

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CtBP1 Rabbit Polyclonal Antibody (orb588239) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHGDH (phospho Thr204) rabbit pAb
UB-GEN-10263 100 µL

PHGDH (phospho Thr204) rabbit pAb

Sign In for Pricing
View Details
pCMV-TagBFP-PLEKHM1-3×FLAG-Neo Plasmid
PVT46769 2 µg

pCMV-TagBFP-PLEKHM1-3×FLAG-Neo Plasmid

Sign In for Pricing
View Details
Recombinant Mycoplasma Hyopneumoniae rpmB Protein (aa 1-64) (strain 7448)
VAng-Lsx06584-50gEcoli 50 µg (E. coli)

Recombinant Mycoplasma Hyopneumoniae rpmB Protein (aa 1-64) (strain 7448)

Sign In for Pricing
View Details
anti-Betacellulin
YF-PA10528 100 ug

anti-Betacellulin

Sign In for Pricing
View Details
Canine Ankyrin repeat and SOCS box protein 5 (ASB5) ELISA kit
GTR10399623 96 Well

Canine Ankyrin repeat and SOCS box protein 5 (ASB5) ELISA kit

Sign In for Pricing
View Details
Human Heat Shock Protein 70 (HSP70) ELISA Kit
MBS2702637-01 24 Strip Well

Human Heat Shock Protein 70 (HSP70) ELISA Kit

Sign In for Pricing
View Details