Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNJ6 Peptide - C-terminal region

KCNJ6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KCNJ6, GIRK2, KATP2, KCNJ7

UniProt

P48051

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCNJ6 Rabbit Polyclonal Antibody (orb575367) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AELASRAELPLSWSVSSKLNQHAELETEEEEKNLEEQTERNGDVANLENE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rac 1-Oleoyl-3-chloropropanediol-d5
TRC-O526802-25MG 25 mg

rac 1-Oleoyl-3-chloropropanediol-d5

Sign In for Pricing
View Details
ZNF648 (NM_001009992) Human Recombinant Protein
TP320260M 100 µg

ZNF648 (NM_001009992) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant IMPDH2 Antibody
RC-5763-01 50 μL

Recombinant IMPDH2 Antibody

Sign In for Pricing
View Details
Recombinant IMPDH2 Antibody
RC-5763-02 100 µL

Recombinant IMPDH2 Antibody

Sign In for Pricing
View Details
Recombinant IMPDH2 Antibody
RC-5763-03 1 mL

Recombinant IMPDH2 Antibody

Sign In for Pricing
View Details
PHEMX (TSPAN32) Human Gene Knockout Kit (CRISPR)
KN424210 1 Kit

PHEMX (TSPAN32) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details