Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPEM2 Peptide - C-terminal region

SPEM2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C17orf74

UniProt

Q0P670

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPEM2 Rabbit Polyclonal Antibody (orb325852) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_783861

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KVQAADPAPPPTMFVPLSRNPGGNANYQVYDSLELKRQVQKSRARSSSLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFT80 CRISPR Knock Out 293T Cell Line (Human)
24296141 1x 10^6 Cells / 1.0 mL

IFT80 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
CD90/Thy1 polyclonal antibody
BS77036-01 50 µL

CD90/Thy1 polyclonal antibody

Sign In for Pricing
View Details
CD90/Thy1 polyclonal antibody
BS77036-02 100 µL

CD90/Thy1 polyclonal antibody

Sign In for Pricing
View Details
LONRF3 antibody
70R-2808 100 µL

LONRF3 antibody

Sign In for Pricing
View Details
Prepro-Chromogranin A (342-355) / WE-14 (Human) - FAM Labeled
FG-053-26A 1 nmol

Prepro-Chromogranin A (342-355) / WE-14 (Human) - FAM Labeled

Sign In for Pricing
View Details
Human Liver X Receptor Alpha (LXRa) Protein
abx168205-01 10 µg

Human Liver X Receptor Alpha (LXRa) Protein

Sign In for Pricing
View Details