Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPEM2 Peptide - C-terminal region

SPEM2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C17orf74

UniProt

Q0P670

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPEM2 Rabbit Polyclonal Antibody (orb325852) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_783861

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KVQAADPAPPPTMFVPLSRNPGGNANYQVYDSLELKRQVQKSRARSSSLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Angiopoietin 2 (ANGPT2)
SIPA005Bo01-01 10 µg

Recombinant Angiopoietin 2 (ANGPT2)

Sign In for Pricing
View Details
Recombinant Angiopoietin 2 (ANGPT2)
SIPA005Bo01-02 50 µg

Recombinant Angiopoietin 2 (ANGPT2)

Sign In for Pricing
View Details
Recombinant Angiopoietin 2 (ANGPT2)
SIPA005Bo01-03 200 µg

Recombinant Angiopoietin 2 (ANGPT2)

Sign In for Pricing
View Details
Recombinant Angiopoietin 2 (ANGPT2)
SIPA005Bo01-04 1 mg

Recombinant Angiopoietin 2 (ANGPT2)

Sign In for Pricing
View Details
Recombinant Angiopoietin 2 (ANGPT2)
SIPA005Bo01-05 5 mg

Recombinant Angiopoietin 2 (ANGPT2)

Sign In for Pricing
View Details
D-JNKI-1
C06858-100mg 100 mg

D-JNKI-1

Sign In for Pricing
View Details