Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LYPD6 Peptide - C-terminal region

LYPD6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LYPD6, UNQ3023/PRO9821

UniProt

Q86Y78

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LYPD6 Rabbit Polyclonal Antibody (orb582079) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KAAQSRDFTVKDIIYLHPSTTPYPGGFKCFTCEKAADNYECNRWAPDIYC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Plzf/ZBTB16 Antibody Picoband® Fluoro647 Conjugated
A00817-1-Fluoro647 100 µg/Vial

Anti-Plzf/ZBTB16 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Human Palate/Lung And Nasal Epithelium Associated Protein (PLUNC) ELISA Kit
RD-PLUNC-Hu-48Tests 48 Tests

Human Palate/Lung And Nasal Epithelium Associated Protein (PLUNC) ELISA Kit

Sign In for Pricing
View Details
GCNT3 (Biotin)
563448-01 50 µg

GCNT3 (Biotin)

Sign In for Pricing
View Details
GCNT3 (Biotin)
563448-02 100 µg

GCNT3 (Biotin)

Sign In for Pricing
View Details
POMC Mouse mAb
MBS8601930-01 0.1 mL

POMC Mouse mAb

Sign In for Pricing
View Details
POMC Mouse mAb
MBS8601930-02 0.1 mL (AF405L)

POMC Mouse mAb

Sign In for Pricing
View Details