Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHDC2 Peptide - C-terminal region

KLHDC2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LCP, HCLP1, HCLP-1

UniProt

Q9Y2U9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLHDC2 Rabbit Polyclonal Antibody (orb582589) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055130

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FSVQPKSLVRLSLEAVICFKEMLANSWNCLPKHLLHSVNQRFGSNNTSGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Tissue Inhibitors Of Metalloproteinase 4 (TIMP4)
TRV-0053678-01 20 µL

Polyclonal Antibody to Tissue Inhibitors Of Metalloproteinase 4 (TIMP4)

Sign In for Pricing
View Details
Polyclonal Antibody to Tissue Inhibitors Of Metalloproteinase 4 (TIMP4)
TRV-0053678-02 100 µL

Polyclonal Antibody to Tissue Inhibitors Of Metalloproteinase 4 (TIMP4)

Sign In for Pricing
View Details
Polyclonal Antibody to Tissue Inhibitors Of Metalloproteinase 4 (TIMP4)
TRV-0053678-03 200 µL

Polyclonal Antibody to Tissue Inhibitors Of Metalloproteinase 4 (TIMP4)

Sign In for Pricing
View Details
Polyclonal Antibody to Tissue Inhibitors Of Metalloproteinase 4 (TIMP4)
TRV-0053678-04 1 mL

Polyclonal Antibody to Tissue Inhibitors Of Metalloproteinase 4 (TIMP4)

Sign In for Pricing
View Details
RABAC1 Protein Vector (Mouse) (pPB-N-His)
PV221855 500 ng

RABAC1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Prostate Specific Antigen (PSA) (Free), Antibody
GWB-E50FB0 1 mg

Prostate Specific Antigen (PSA) (Free), Antibody

Sign In for Pricing
View Details