Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHDC2 Peptide - C-terminal region

KLHDC2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

LCP, HCLP1, HCLP-1

UniProt

Q9Y2U9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLHDC2 Rabbit Polyclonal Antibody (orb582589) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055130

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FSVQPKSLVRLSLEAVICFKEMLANSWNCLPKHLLHSVNQRFGSNNTSGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HTRA4 Rabbit Polyclonal Antibody
TA372758 100 µL

HTRA4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) LSB3 Polyclonal Antibody
MBS7157816 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) LSB3 Polyclonal Antibody

Sign In for Pricing
View Details
BRCC3 Peptide
DF7942-BP 1 mg

BRCC3 Peptide

Sign In for Pricing
View Details
Glycidyl Docosahexaenoate-d5
MBS6057476-01 1 mg

Glycidyl Docosahexaenoate-d5

Sign In for Pricing
View Details
Glycidyl Docosahexaenoate-d5
MBS6057476-02 5x 1 mg

Glycidyl Docosahexaenoate-d5

Sign In for Pricing
View Details
Aimp1, Recombinant, Mouse, aa2-310, His-SUMO-Tag (Aminoacyl tRNA Synthase Complex-interacting Multifunctional Protein 1)
372197-01 20 µg

Aimp1, Recombinant, Mouse, aa2-310, His-SUMO-Tag (Aminoacyl tRNA Synthase Complex-interacting Multifunctional Protein 1)

Sign In for Pricing
View Details