Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RSPH10B Peptide - N-terminal region

RSPH10B Peptide - N-terminal region

Product Specifications

UniProt

B2RC85

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RSPH10B Rabbit Polyclonal Antibody (orb326068) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: THTWFLKRIRSSQYPLRNEYIGEFVNGYRHGRGKFYYASGAMYDGEWVSN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX1 Antibody - middle region
ARP90120_P050-25UL 25 µL

PAX1 Antibody - middle region

Sign In for Pricing
View Details
RHAMM (H-8) Alexa Fluor® 594
sc-515221 AF594 200 µg/mL

RHAMM (H-8) Alexa Fluor® 594

Sign In for Pricing
View Details
Mouse Myl9 Pre-designed siRNA Set A
SI108967A 1 Each

Mouse Myl9 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Bovine Zinc finger protein 326 (ZNF326) ELISA kit
GTR10379568 96 Well

Bovine Zinc finger protein 326 (ZNF326) ELISA kit

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Pancreas Specific Transcription Factor 1a (PTF1a)
MBS2067904-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Pancreas Specific Transcription Factor 1a (PTF1a)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Pancreas Specific Transcription Factor 1a (PTF1a)
MBS2067904-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Pancreas Specific Transcription Factor 1a (PTF1a)

Sign In for Pricing
View Details