Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RSPH10B Peptide - N-terminal region

RSPH10B Peptide - N-terminal region

Product Specifications

UniProt

B2RC85

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RSPH10B Rabbit Polyclonal Antibody (orb326068) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: THTWFLKRIRSSQYPLRNEYIGEFVNGYRHGRGKFYYASGAMYDGEWVSN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDCD4 Peptide
orb1235405 0.1 mg

PDCD4 Peptide

Sign In for Pricing
View Details
HCST Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV657289 1.0 µg DNA

HCST Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rabbit Polyclonal VENTX Antibody [HRP]
NBP1-77192H 0.1 mL

Rabbit Polyclonal VENTX Antibody [HRP]

Sign In for Pricing
View Details
Rabbit Monoclonal S100A7/Psoriasin Antibody (128) [Alexa Fluor 647]
NBP2-89813AF647 0.1 mL

Rabbit Monoclonal S100A7/Psoriasin Antibody (128) [Alexa Fluor 647]

Sign In for Pricing
View Details
Capg sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6416007 1.0 µg DNA

Capg sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
1,4-Naphthoquinone-NH-C2-NH-Trolox
orb3173309-01 50 mg

1,4-Naphthoquinone-NH-C2-NH-Trolox

Sign In for Pricing
View Details