Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK6 Peptide - N-terminal region

MAPK6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ERK3, PRKM6, p97MAPK, HsT17250

UniProt

Q16659

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAPK6 Rabbit Polyclonal Antibody (orb326104) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005254596

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LDHDNIVKVFEILGPSGSQLTDDVGSLTELNSVYIVQEYMETDLANVLEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Nxf2 (NM_001289736) AAV Particle
MR230843A1V 250 µL

Mouse Nxf2 (NM_001289736) AAV Particle

Sign In for Pricing
View Details
Famotidine
GP1586-1g 1 g

Famotidine

Sign In for Pricing
View Details
RFX8 sgRNA CRISPR Lentivector (Human) (Target 3)
K2799504 1.0 µg DNA

RFX8 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
IFITM1 shRNA (m) Lentiviral Particles
sc-44550-V 200 µL

IFITM1 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
SLC26A2 3'UTR Luciferase Stable Cell Line
TU023528 1.0 mL

SLC26A2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
AG 825
sc-202045C 100 mg

AG 825

Sign In for Pricing
View Details