Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK6 Peptide - N-terminal region

MAPK6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ERK3, PRKM6, p97MAPK, HsT17250

UniProt

Q16659

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAPK6 Rabbit Polyclonal Antibody (orb326104) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005254596

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LDHDNIVKVFEILGPSGSQLTDDVGSLTELNSVYIVQEYMETDLANVLEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHRNA5
CSB-CL005391HU 10 μg Plasmid + 200 μL Glycerol

CHRNA5

Sign In for Pricing
View Details
FLNC Peptide - N-terminal region (AAP64454)
AAP64454-100UG 100 µg

FLNC Peptide - N-terminal region (AAP64454)

Sign In for Pricing
View Details
RNF123 Peptide
DF9488-BP 1 mg

RNF123 Peptide

Sign In for Pricing
View Details
(R) - (+) -Citronellal
HY-111664-01 100 mg

(R) - (+) -Citronellal

Sign In for Pricing
View Details
(R) - (+) -Citronellal
HY-111664-02 10 mM - 1 mL

(R) - (+) -Citronellal

Sign In for Pricing
View Details
(R) - (+) -Citronellal
HY-111664-03 500 mg

(R) - (+) -Citronellal

Sign In for Pricing
View Details