Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK11 Peptide - N-terminal region

MAPK11 Peptide - N-terminal region

Product Specifications

Product Name Alternative

P38B, SAPK2, p38-2, PRKM11, SAPK2B, p38Beta, P38BETA2

UniProt

Q15759

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAPK11 Rabbit Polyclonal Antibody (orb326105) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002742

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

T2R50 Polyclonal Antibody, RBITC Conjugated
bs-11617R-RBITC 100 µL

T2R50 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
PM20D2, CT (PM20D2, ACY1L2, Peptidase M20 domain-containing protein 2, Aminoacylase-1-like protein 2) (MaxLight 750)
MBS6335145-01 0.1 mL

PM20D2, CT (PM20D2, ACY1L2, Peptidase M20 domain-containing protein 2, Aminoacylase-1-like protein 2) (MaxLight 750)

Sign In for Pricing
View Details
PM20D2, CT (PM20D2, ACY1L2, Peptidase M20 domain-containing protein 2, Aminoacylase-1-like protein 2) (MaxLight 750)
MBS6335145-02 5x 0.1 mL

PM20D2, CT (PM20D2, ACY1L2, Peptidase M20 domain-containing protein 2, Aminoacylase-1-like protein 2) (MaxLight 750)

Sign In for Pricing
View Details
ADAL protein (His tag)
80R-3769 100 ug

ADAL protein (His tag)

Sign In for Pricing
View Details
Cytokeratin 19 Recombinant Antibody
bsm-52059R-01 20 µL

Cytokeratin 19 Recombinant Antibody

Sign In for Pricing
View Details
Cytokeratin 19 Recombinant Antibody
bsm-52059R-02 100 µL

Cytokeratin 19 Recombinant Antibody

Sign In for Pricing
View Details