Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK11 Peptide - N-terminal region

MAPK11 Peptide - N-terminal region

Product Specifications

Product Name Alternative

P38B, SAPK2, p38-2, PRKM11, SAPK2B, p38Beta, P38BETA2

UniProt

Q15759

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAPK11 Rabbit Polyclonal Antibody (orb326105) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002742

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

bcl 6 (BCL6) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6C7]
TA803402BM 100 µL

bcl 6 (BCL6) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6C7]

Sign In for Pricing
View Details
Recombinant Human SUMO2 Protein
E30P12529 20 µg

Recombinant Human SUMO2 Protein

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Transposase for insertion sequence-like element IS431mec (tnp)
MBS1111177-01 0.02 mg (E-Coli)

Recombinant Staphylococcus aureus Transposase for insertion sequence-like element IS431mec (tnp)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Transposase for insertion sequence-like element IS431mec (tnp)
MBS1111177-02 0.1 mg (E-Coli)

Recombinant Staphylococcus aureus Transposase for insertion sequence-like element IS431mec (tnp)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Transposase for insertion sequence-like element IS431mec (tnp)
MBS1111177-03 0.02 mg (Yeast)

Recombinant Staphylococcus aureus Transposase for insertion sequence-like element IS431mec (tnp)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Transposase for insertion sequence-like element IS431mec (tnp)
MBS1111177-04 0.1 mg (Yeast)

Recombinant Staphylococcus aureus Transposase for insertion sequence-like element IS431mec (tnp)

Sign In for Pricing
View Details