SCO1 Peptide - C-terminal region
SCO1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
SCO1, SCOD1
UniProt
O75880
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SCO1 Rabbit Polyclonal Antibody (orb583227) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PSMA7 Mouse Monoclonal Antibody [Clone ID: OTI8B11]](https://cdn.genprice.uk/products/937/68dd18ba061270361e90882c/imageurl/cf810368.webp)
CF810368 100 µg
PSMA7 Mouse Monoclonal Antibody [Clone ID: OTI8B11]
Sign In for Pricing
View Details 
BNC683347-500 1x 500 µL
NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/3347), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 