Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCO1 Peptide - C-terminal region

SCO1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SCO1, SCOD1

UniProt

O75880

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SCO1 Rabbit Polyclonal Antibody (orb583227) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ULK3 Rabbit Monoclonal Antibody [Clone ID: R08-7J3]
TA385524 100 µL

ULK3 Rabbit Monoclonal Antibody [Clone ID: R08-7J3]

Sign In for Pricing
View Details
IFI16 Antibody
KC-27362-01 50 μL

IFI16 Antibody

Sign In for Pricing
View Details
IFI16 Antibody
KC-27362-02 100 µL

IFI16 Antibody

Sign In for Pricing
View Details
IFI16 Antibody
KC-27362-03 1 mL

IFI16 Antibody

Sign In for Pricing
View Details
PIP5K1A Rabbit Polyclonal Antibody
HA500201 100 µL

PIP5K1A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CAPN15 Polyclonal Antibody
E-AB-17763-01 20 µL

CAPN15 Polyclonal Antibody

Sign In for Pricing
View Details