Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A6 Peptide - middle region

S100A6 Peptide - middle region

Product Specifications

Product Name Alternative

2A9, PRA, 5B10, CABP, CACY, S10A6

UniProt

P06703

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with S100A6 Rabbit Polyclonal Antibody (orb326119) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055439

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hydrocortisone-2,2,4,6,6,21,21-d7 (d6 Major)(Cortisol)
TRC-H714617-25MG 25 mg

Hydrocortisone-2,2,4,6,6,21,21-d7 (d6 Major)(Cortisol)

Sign In for Pricing
View Details
EED (NM_003797) Human Over-expression Lysate
LC401248 20 µg

EED (NM_003797) Human Over-expression Lysate

Sign In for Pricing
View Details
XPO6 Rabbit Polyclonal Antibody
TA383382 100 µL

XPO6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
APC Anti-Mouse CD49b/pan-NK cells Antibody[DX5]
E-AB-F1116E-01 50 Tests

APC Anti-Mouse CD49b/pan-NK cells Antibody[DX5]

Sign In for Pricing
View Details
APC Anti-Mouse CD49b/pan-NK cells Antibody[DX5]
E-AB-F1116E-02 100 Tests

APC Anti-Mouse CD49b/pan-NK cells Antibody[DX5]

Sign In for Pricing
View Details
APC Anti-Mouse CD49b/pan-NK cells Antibody[DX5]
E-AB-F1116E-03 2x 100 Tests

APC Anti-Mouse CD49b/pan-NK cells Antibody[DX5]

Sign In for Pricing
View Details