S100A6 Peptide - middle region
S100A6 Peptide - middle region
Product Specifications
Product Name Alternative
2A9, PRA, 5B10, CABP, CACY, S10A6
UniProt
P06703
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with S100A6 Rabbit Polyclonal Antibody (orb326119) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_055439
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Phosphotyrosine (pYpY Motif) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 9F1]](https://cdn.genprice.uk/products/937/68dd1899061270361e8fb648/imageurl/am00126pu-n.webp)
AM00126PU-N 100 µg
Phosphotyrosine (pYpY Motif) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 9F1]
Sign In for Pricing
View Details ![ASH2L Mouse Monoclonal Antibody [Clone ID: OTI7D11]](https://cdn.genprice.uk/products/937/68dd18bb061270361e9089f0/imageurl/cf810989.webp)
CF810989 100 µg
ASH2L Mouse Monoclonal Antibody [Clone ID: OTI7D11]
Sign In for Pricing
View Details 
AP31877PU-N 50 µL
Cadherin like 23 (CDH23) (61-110) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
AP13706PU-N 400 µL
Activin Receptor Type IA (ACVR1) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
TRC-E589606-50MG 50 mg
(5a,6a)-Epoxy-17a-hydroxy-pregnane-3,20-dione 20-Bis(ethyleneketal)
Sign In for Pricing
View Details