Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A6 Peptide - N-terminal region

S100A6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2A9, PRA, 5B10, CABP, CACY, S10A6

UniProt

P06703

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with S100A6 Rabbit Polyclonal Antibody (orb326120) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055439

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTGES2/Gbf1 Rabbit Polyclonal Antibody (Fluoro647)
orb3101370 100 µg

PTGES2/Gbf1 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Recombinant Transient Receptor Potential Cation Channel Subfamily V, Member 2 (TRPV2)
MBS2029923-01 0.01 mg

Recombinant Transient Receptor Potential Cation Channel Subfamily V, Member 2 (TRPV2)

Sign In for Pricing
View Details
Recombinant Transient Receptor Potential Cation Channel Subfamily V, Member 2 (TRPV2)
MBS2029923-02 0.05 mg

Recombinant Transient Receptor Potential Cation Channel Subfamily V, Member 2 (TRPV2)

Sign In for Pricing
View Details
Recombinant Transient Receptor Potential Cation Channel Subfamily V, Member 2 (TRPV2)
MBS2029923-03 0.1 mg

Recombinant Transient Receptor Potential Cation Channel Subfamily V, Member 2 (TRPV2)

Sign In for Pricing
View Details
Recombinant Transient Receptor Potential Cation Channel Subfamily V, Member 2 (TRPV2)
MBS2029923-04 0.2 mg

Recombinant Transient Receptor Potential Cation Channel Subfamily V, Member 2 (TRPV2)

Sign In for Pricing
View Details
Recombinant Transient Receptor Potential Cation Channel Subfamily V, Member 2 (TRPV2)
MBS2029923-05 0.5 mg

Recombinant Transient Receptor Potential Cation Channel Subfamily V, Member 2 (TRPV2)

Sign In for Pricing
View Details