Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A6 Peptide - N-terminal region

S100A6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2A9, PRA, 5B10, CABP, CACY, S10A6

UniProt

P06703

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with S100A6 Rabbit Polyclonal Antibody (orb326120) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055439

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit POU Domain, Class 2, Transcription Factor 2 / OCT2 (POU2F2) ELISA Kit
abx362543 96 Well

Rabbit POU Domain, Class 2, Transcription Factor 2 / OCT2 (POU2F2) ELISA Kit

Sign In for Pricing
View Details
Antifade Mounting Medium with Hoechst 33342
P0133-25ml 25 mL

Antifade Mounting Medium with Hoechst 33342

Sign In for Pricing
View Details
CRISP2 Protein Lysate
OCOA13705-20UG 20 µg

CRISP2 Protein Lysate

Sign In for Pricing
View Details
TLR6 (Toll-like Receptor 6, CD286) (HRP)
MBS6180808-01 0.1 mL

TLR6 (Toll-like Receptor 6, CD286) (HRP)

Sign In for Pricing
View Details
TLR6 (Toll-like Receptor 6, CD286) (HRP)
MBS6180808-02 5x 0.1 mL

TLR6 (Toll-like Receptor 6, CD286) (HRP)

Sign In for Pricing
View Details
Sema3b sgRNA CRISPR Lentivector (Rat) (Target 3)
K6482604 1.0 µg DNA

Sema3b sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details