Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP4R3B Peptide - middle region

PPP4R3B Peptide - middle region

Product Specifications

Product Name Alternative

PSY2, smk1, FLFL2, SMEK2, PP4R3B

UniProt

Q5MIZ7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPP4R3B Rabbit Polyclonal Antibody (orb326201) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EYVQTFKGLKTKYEQEKDRQNQKLNSNRFRRDAKALEEDEEMWFNEDEEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pelo sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3663704 1.0 µg DNA

Pelo sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Goat Coiled coil domain containing protein 127 (CCDC127) ELISA kit
GTR10379307 96 Well

Goat Coiled coil domain containing protein 127 (CCDC127) ELISA kit

Sign In for Pricing
View Details
Zfp37 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3935104 1.0 µg DNA

Zfp37 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Anti-Neisseria gonorrhoeae Mouse Monoclonal Antibody - Library Pack
orb1148212 4 x 100 ug

Anti-Neisseria gonorrhoeae Mouse Monoclonal Antibody - Library Pack

Sign In for Pricing
View Details
SARS-CoV-2 Mpro-IN-19
orb3134317-01 10 mg

SARS-CoV-2 Mpro-IN-19

Sign In for Pricing
View Details
SARS-CoV-2 Mpro-IN-19
orb3134317-02 50 mg

SARS-CoV-2 Mpro-IN-19

Sign In for Pricing
View Details