UVSSA Peptide - C-terminal region
UVSSA Peptide - C-terminal region
Product Specifications
Product Name Alternative
UVSSA, KIAA1530
UniProt
Q2YD98
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with UVSSA Rabbit Polyclonal Antibody (orb326209) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_006713960
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GQDLGSSRYSGKGRGKKRRYPSLTNLKAQADTARARIGRKVFAKAAVRRV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB1934-500 1x 500 µL
HSV1 (Herpes Simplex Virus Type I) (HSV1/1934), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
#30109 1 Kit
CellBrite® Steady 685 Membrane Staining Kit, 500 Labelings
Sign In for Pricing
View Details ![PIK3R5 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B11]](https://cdn.genprice.uk/products/937/68dd1b71061270361ea18621/imageurl/ta505879am.webp)
TA505879AM 100 µL
PIK3R5 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B11]
Sign In for Pricing
View Details