Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UVSSA Peptide - C-terminal region

UVSSA Peptide - C-terminal region

Product Specifications

Product Name Alternative

UVSSA, KIAA1530

UniProt

Q2YD98

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UVSSA Rabbit Polyclonal Antibody (orb326209) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_006713960

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GQDLGSSRYSGKGRGKKRRYPSLTNLKAQADTARARIGRKVFAKAAVRRV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Amino-1-tert-butyl-3-(3-bromobenzyl)pyrazolo[3,4-d]pyrimidine
TRC-A602985-10MG 10 mg

4-Amino-1-tert-butyl-3-(3-bromobenzyl)pyrazolo[3,4-d]pyrimidine

Sign In for Pricing
View Details
(Z)-Heptyl Hexadec-9-enoate
TRC-H283190-25MG 25 mg

(Z)-Heptyl Hexadec-9-enoate

Sign In for Pricing
View Details
Spinorphin TFA Salt
TRC-S681958-5MG 5 mg

Spinorphin TFA Salt

Sign In for Pricing
View Details
KLLN Human Gene Knockout Kit (CRISPR)
KN425189 1 Kit

KLLN Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS627112 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Tissue Total RNA, Colon
CR562869 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details