Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRAGC Peptide - N-terminal region

RRAGC Peptide - N-terminal region

Product Specifications

Product Name Alternative

RRAGC

UniProt

Q9HB90

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RRAGC Rabbit Polyclonal Antibody (orb583637) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071440

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MSLQYGAEETPLAGSYGAADSFPKDFGYGVEEEEEEAAAAGGGVGAGAGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methylzedoarondiol
orb1942958-01 5 mg

Methylzedoarondiol

Sign In for Pricing
View Details
Methylzedoarondiol
orb1942958-02 50 mg

Methylzedoarondiol

Sign In for Pricing
View Details
MAGEC3 Polyclonal Antibody
A59738-020 20 µL

MAGEC3 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human C-C Motif Chemokine 5/CCL5/RANTES
C062-50ug 50 µg

Recombinant Human C-C Motif Chemokine 5/CCL5/RANTES

Sign In for Pricing
View Details
ADAM28 Rabbit Polyclonal Antibody (Biotin)
orb113931 100 µL

ADAM28 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
WDSUB1, ID (WD Repeat, SAM And U-box Domain-containing Protein 1, WDSAM1) (FITC)
MBS6505930-01 0.2 mL

WDSUB1, ID (WD Repeat, SAM And U-box Domain-containing Protein 1, WDSAM1) (FITC)

Sign In for Pricing
View Details