Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RRAGC Peptide - N-terminal region

RRAGC Peptide - N-terminal region

Product Specifications

Product Name Alternative

RRAGC

UniProt

Q9HB90

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RRAGC Rabbit Polyclonal Antibody (orb583637) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071440

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MSLQYGAEETPLAGSYGAADSFPKDFGYGVEEEEEEAAAAGGGVGAGAGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WNT16 293 Cell Lysate
404917 0.1 mg

WNT16 293 Cell Lysate

Sign In for Pricing
View Details
Akap7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4777805 3x 1.0 µg

Akap7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Anti-EGFR
DB-092-0.5 500 μl

Anti-EGFR

Sign In for Pricing
View Details
Recombinant Human TJP1 Protein, N-His
bs-101829P-01 20 µg

Recombinant Human TJP1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human TJP1 Protein, N-His
bs-101829P-02 50 µg

Recombinant Human TJP1 Protein, N-His

Sign In for Pricing
View Details
Sphingosine 1-phosphate Receptor 1 (S1PR1) Rat ELISA Kit
H2786 96 Tests

Sphingosine 1-phosphate Receptor 1 (S1PR1) Rat ELISA Kit

Sign In for Pricing
View Details