Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NECAB1 Peptide - N-terminal region

NECAB1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EFCBP1, STIP-1

UniProt

Q8N987

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NECAB1 Rabbit Polyclonal Antibody (orb326222) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071746

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DSQETSPSSNNSSEELSSALHLSKGMSIFLDILRRADKNDDGKLSFEEFK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vented Round Snap-Lock Containers X 500
VRSL-500 500 Each

Vented Round Snap-Lock Containers X 500

Sign In for Pricing
View Details
OAS2 Rabbit Polyclonal Antibody
TA379433 100 µL

OAS2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
P21 / WAF1 (CIP1/823), CF488A conjugate, 0.1mg/mL
BNC880823-100 1x 100 µL

P21 / WAF1 (CIP1/823), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P4HB (C-term) Rabbit Polyclonal Antibody
AP17615PU-N 400 µL

P4HB (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(Phenylthio)acetaldehyde Diethyl Acetal
TRC-P337075-10MG 10 mg

(Phenylthio)acetaldehyde Diethyl Acetal

Sign In for Pricing
View Details
Human VGCNL1 (NALCN) activation kit by CRISPRa
GA116908 1 Kit

Human VGCNL1 (NALCN) activation kit by CRISPRa

Sign In for Pricing
View Details