Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NECAB1 Peptide - N-terminal region

NECAB1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EFCBP1, STIP-1

UniProt

Q8N987

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NECAB1 Rabbit Polyclonal Antibody (orb326222) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071746

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DSQETSPSSNNSSEELSSALHLSKGMSIFLDILRRADKNDDGKLSFEEFK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR4698 Human qPCR Primer Pair (MI0017331)
HP301090 200 Reactions

MIR4698 Human qPCR Primer Pair (MI0017331)

Sign In for Pricing
View Details
Recombinant Human Galectin-14 protein (N-His)
PKSH034189-01 20 µg

Recombinant Human Galectin-14 protein (N-His)

Sign In for Pricing
View Details
Recombinant Human Galectin-14 protein (N-His)
PKSH034189-02 100 µg

Recombinant Human Galectin-14 protein (N-His)

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS800575 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
GOT1 Polyclonal Antibody
E-AB-14773-01 20 µL

GOT1 Polyclonal Antibody

Sign In for Pricing
View Details
GOT1 Polyclonal Antibody
E-AB-14773-02 60 µL

GOT1 Polyclonal Antibody

Sign In for Pricing
View Details