Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MPI Peptide - C-terminal region

MPI Peptide - C-terminal region

Product Specifications

Product Name Alternative

MPI, PMI1

UniProt

P34949

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MPI Rabbit Polyclonal Antibody (orb584951) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002426

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QGTVIASTPTTQTPIPLQRGGVLFIGANESVSLKLTEPKDLLIFRACCLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human LRG1 shRNA (UAS) - Lentiviral human LRG1 shRNA (UAS, GFP) (100)
GTR15342780 1 Vial

Lentiviral human LRG1 shRNA (UAS) - Lentiviral human LRG1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
BGAT (19J2) Rabbit Monoclonal Antibody
E28M6435 100 µL

BGAT (19J2) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
C1orf124 sgRNA CRISPR Lentivector (Human) (Target 2)
K0211903 1.0 µg DNA

C1orf124 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Rabbit ApoC1 (Apolipoprotein C1) ELISA Kit
ERB0012 96 Tests

Rabbit ApoC1 (Apolipoprotein C1) ELISA Kit

Sign In for Pricing
View Details
Prostaglandin I2 Receptor (PTGIR) Rabbit Polyclonal Antibody
AP01428PU-N 100 µg

Prostaglandin I2 Receptor (PTGIR) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STAT5B Polyclonal Antibody
A72903-100 100 µL

STAT5B Polyclonal Antibody

Sign In for Pricing
View Details