Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WWOX Peptide - N-terminal region

WWOX Peptide - N-terminal region

Product Specifications

Product Name Alternative

WWOX, FOR, WOX1

UniProt

Q9NZC7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WWOX Rabbit Polyclonal Antibody (orb585010) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RB Antibody
orb623005 0.1 mg

CD45RB Antibody

Sign In for Pricing
View Details
Zfp1 Mouse shRNA Lentiviral Particle (Locus ID 22640)
TL502446V 500 µL Each

Zfp1 Mouse shRNA Lentiviral Particle (Locus ID 22640)

Sign In for Pricing
View Details
RCN1, CT (RCN1, RCN, Reticulocalbin-1) (Azide free) (HRP)
MBS6341063-01 0.2 mL

RCN1, CT (RCN1, RCN, Reticulocalbin-1) (Azide free) (HRP)

Sign In for Pricing
View Details
RCN1, CT (RCN1, RCN, Reticulocalbin-1) (Azide free) (HRP)
MBS6341063-02 5x 0.2 mL

RCN1, CT (RCN1, RCN, Reticulocalbin-1) (Azide free) (HRP)

Sign In for Pricing
View Details
ULBP-2 Protein, Human, Recombinant (His & Avi)
TMPK-00136-01 5 µg

ULBP-2 Protein, Human, Recombinant (His & Avi)

Sign In for Pricing
View Details
ULBP-2 Protein, Human, Recombinant (His & Avi)
TMPK-00136-02 10 µg

ULBP-2 Protein, Human, Recombinant (His & Avi)

Sign In for Pricing
View Details