WWOX Peptide - N-terminal region
WWOX Peptide - N-terminal region
Product Specifications
Product Name Alternative
WWOX, FOR, WOX1
UniProt
Q9NZC7
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with WWOX Rabbit Polyclonal Antibody (orb585010) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6479669-01 0.1 mL
Heartworm, Canine (Dirofilaria immitis) (MaxLight 490)
Sign In for Pricing
View Details MBS6479669-02 5x 0.1 mL
Heartworm, Canine (Dirofilaria immitis) (MaxLight 490)
Sign In for Pricing
View Details 
MBS1004780-01 1 mg (E-Coli)
Recombinant Escherichia coli O81 Enterobactin exporter EntS (entS), partial
Sign In for Pricing
View Details MBS1004780-02 1 mg (Yeast)
Recombinant Escherichia coli O81 Enterobactin exporter EntS (entS), partial
Sign In for Pricing
View Details