WDR43 Peptide - N-terminal region
WDR43 Peptide - N-terminal region
Product Specifications
Product Name Alternative
WDR43, KIAA0007, UTP5
UniProt
Q15061
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
NCBI Accession Number
NP_055946
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AHLSGTCTCLAWAPARLQAKESPQRKKRKSEAVGMSNQTDLLALGTAVGS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2148097-01 0.1 mL
APC-Linked Polyclonal Antibody to Glutamate Receptor, Ionotropic, AMPA 4 (GRIA4)
Sign In for Pricing
View Details MBS2148097-02 0.2 mL
APC-Linked Polyclonal Antibody to Glutamate Receptor, Ionotropic, AMPA 4 (GRIA4)
Sign In for Pricing
View Details MBS2148097-03 0.5 mL
APC-Linked Polyclonal Antibody to Glutamate Receptor, Ionotropic, AMPA 4 (GRIA4)
Sign In for Pricing
View Details MBS2148097-04 1 mL
APC-Linked Polyclonal Antibody to Glutamate Receptor, Ionotropic, AMPA 4 (GRIA4)
Sign In for Pricing
View Details MBS2148097-05 5 mL
APC-Linked Polyclonal Antibody to Glutamate Receptor, Ionotropic, AMPA 4 (GRIA4)
Sign In for Pricing
View Details MBS2148097-06 5x 5 mL
APC-Linked Polyclonal Antibody to Glutamate Receptor, Ionotropic, AMPA 4 (GRIA4)
Sign In for Pricing
View Details