Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR43 Peptide - N-terminal region

WDR43 Peptide - N-terminal region

Product Specifications

Product Name Alternative

WDR43, KIAA0007, UTP5

UniProt

Q15061

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_055946

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AHLSGTCTCLAWAPARLQAKESPQRKKRKSEAVGMSNQTDLLALGTAVGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPEL1 CytoSection
TS427890P5 25 Slides

RPEL1 CytoSection

Sign In for Pricing
View Details
TP63 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV698783 1.0 µg DNA

TP63 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Focal Adhesion Kinase antibody
70R-50289 100 µL

Focal Adhesion Kinase antibody

Sign In for Pricing
View Details
IP3 Receptor Antibody
E19-3000-1 50 µg - 50 µL

IP3 Receptor Antibody

Sign In for Pricing
View Details
Lentiviral mouse Rgs10 shRNA (UAS) - Lentiviral mouse Rgs10 shRNA (UAS, RFP) plasmid
GTR15259045 1 Vial

Lentiviral mouse Rgs10 shRNA (UAS) - Lentiviral mouse Rgs10 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
IFNA1 (Interferon alpha-1/13, IFN-alpha-1/13, Interferon alpha-D, LeIF D, IFNA13, MGC138207, MGC138505, MGC138507)
128262 100 µg

IFNA1 (Interferon alpha-1/13, IFN-alpha-1/13, Interferon alpha-D, LeIF D, IFNA13, MGC138207, MGC138505, MGC138507)

Sign In for Pricing
View Details