Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACOT7 Peptide - C-terminal region

ACOT7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ACT, ACH1, BACH, LACH, LACH1, hBACH, CTE-II

UniProt

O00154

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACOT7 Rabbit Polyclonal Antibody (orb327225) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RYRAASAFFTYVSLSQEGRSLPVPQLVPETEDEKKRFEEGKGRYLQMKAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aldicarb-d3 Sulfoxide
TRC-A514667-1MG 1 mg

Aldicarb-d3 Sulfoxide

Sign In for Pricing
View Details
Human MDS2 activation kit by CRISPRa
GA116915 1 Kit

Human MDS2 activation kit by CRISPRa

Sign In for Pricing
View Details
Ep-CAM / CD326 (EGP40/837), CF594 conjugate, 0.1mg/mL
BNC940837-100 1x 100 µL

Ep-CAM / CD326 (EGP40/837), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HTRA1 Mutant (R310A, E306A) Human Recombinant Protein
TP701130 20 µg

HTRA1 Mutant (R310A, E306A) Human Recombinant Protein

Sign In for Pricing
View Details
Syne4 Mouse Gene Knockout Kit (CRISPR)
KN517058 1 Kit

Syne4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human VDR/NR1I1 Protein (His Tag)
PKSH030931 50 µg

Recombinant Human VDR/NR1I1 Protein (His Tag)

Sign In for Pricing
View Details