Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDH6 Peptide - N-terminal region

CDH6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CAD6, KCAD

UniProt

P55285

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CDH6 Rabbit Polyclonal Antibody (orb327226) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VIQAKDMGGQMGGLSGTTTVNITLTDVNDNPPRFPQSTYQFKTPESSPPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,4-Diaminobenzenesulfonic Acid
TRC-D422573-500MG 500 mg

2,4-Diaminobenzenesulfonic Acid

Sign In for Pricing
View Details
Unconjugated Rabbit Anti-PNA Antibody
AL-2301-2 2 mL

Unconjugated Rabbit Anti-PNA Antibody

Sign In for Pricing
View Details
CMTM6 Antibody
KC-315-01 50 μL

CMTM6 Antibody

Sign In for Pricing
View Details
CMTM6 Antibody
KC-315-02 100 µL

CMTM6 Antibody

Sign In for Pricing
View Details
CMTM6 Antibody
KC-315-03 1 mL

CMTM6 Antibody

Sign In for Pricing
View Details
GCAP2 (GUCA1B) (NM_002098) Human Over-expression Lysate
LC419534 20 µg

GCAP2 (GUCA1B) (NM_002098) Human Over-expression Lysate

Sign In for Pricing
View Details