CEP57 Peptide - middle region
CEP57 Peptide - middle region
Product Specifications
Product Name Alternative
CEP57, KIAA0092, TSP57
UniProt
Q86XR8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CEP57 Rabbit Polyclonal Antibody (orb588106) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_055494
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RLIFEDKATPCVPNARRIKKKKSKPPEKKSSRNYFGAQPHYRLCLGDMPF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PDMM100234-01 20 µg
Recombinant Mouse IGF-1/Human HSA Fusion Protein (His Tag)
Sign In for Pricing
View Details PDMM100234-02 100 µg
Recombinant Mouse IGF-1/Human HSA Fusion Protein (His Tag)
Sign In for Pricing
View Details PDMM100234-03 500 µg
Recombinant Mouse IGF-1/Human HSA Fusion Protein (His Tag)
Sign In for Pricing
View Details PDMM100234-04 1 mg
Recombinant Mouse IGF-1/Human HSA Fusion Protein (His Tag)
Sign In for Pricing
View Details 
