Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEP57 Peptide - middle region

CEP57 Peptide - middle region

Product Specifications

Product Name Alternative

CEP57, KIAA0092, TSP57

UniProt

Q86XR8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CEP57 Rabbit Polyclonal Antibody (orb588106) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055494

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RLIFEDKATPCVPNARRIKKKKSKPPEKKSSRNYFGAQPHYRLCLGDMPF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RNF224 activation kit by CRISPRa
GA118697 1 Kit

Human RNF224 activation kit by CRISPRa

Sign In for Pricing
View Details
GAP43 Rabbit Polyclonal Antibody
TA367658 100 µL

GAP43 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Carboxypeptidase A2 (CPA2) (NM_001869) Human Recombinant Protein
TP720477XL 1 mg

Carboxypeptidase A2 (CPA2) (NM_001869) Human Recombinant Protein

Sign In for Pricing
View Details
SH3MD2 (SH3RF1) Human Gene Knockout Kit (CRISPR)
KN424916 1 Kit

SH3MD2 (SH3RF1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant H Cadherin Antibody
RC-15716-01 50 μL

Recombinant H Cadherin Antibody

Sign In for Pricing
View Details
Recombinant H Cadherin Antibody
RC-15716-02 100 µL

Recombinant H Cadherin Antibody

Sign In for Pricing
View Details