Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HPS1 Peptide - C-terminal region

HPS1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HPS1, HPS

UniProt

Q92902

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HPS1 Rabbit Polyclonal Antibody (orb588107) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005269815

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PSRGGPHLPQHLQDQVQRLMREKLTDWKDFLLVKSRRNITMVSYLEDFPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBX22 Antibody - middle region
MBS3223296-01 0.1 mL

TBX22 Antibody - middle region

Sign In for Pricing
View Details
TBX22 Antibody - middle region
MBS3223296-02 5x 0.1 mL

TBX22 Antibody - middle region

Sign In for Pricing
View Details
CELSR3 HDR Plasmid (h)
sc-405116-HDR 20 µg

CELSR3 HDR Plasmid (h)

Sign In for Pricing
View Details
3alpha,6beta-Dihydroxy-5alpha-androstan-17-one
TRC-D985550-100MG 100 mg

3alpha,6beta-Dihydroxy-5alpha-androstan-17-one

Sign In for Pricing
View Details
Mouse Cldn4 qPCR Primer Pair
QM11134S 200 Tests

Mouse Cldn4 qPCR Primer Pair

Sign In for Pricing
View Details
Aimp2 Rat Pre-designed siRNA Set A
HY-RS26873 1 Set

Aimp2 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details