Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HPS1 Peptide - C-terminal region

HPS1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HPS1, HPS

UniProt

Q92902

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HPS1 Rabbit Polyclonal Antibody (orb588107) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005269815

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PSRGGPHLPQHLQDQVQRLMREKLTDWKDFLLVKSRRNITMVSYLEDFPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD59 Antibody (MACIF/629) [Alexa Fluor 647]
NBP2-47820AF647 0.1 mL

Mouse Monoclonal CD59 Antibody (MACIF/629) [Alexa Fluor 647]

Sign In for Pricing
View Details
PFAS Rabbit Polyclonal Antibody (APC)
orb2602181 100 µg

PFAS Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Recombinant Human SLC5A7, GST-tagged
SLC5A7-2779H 25 µg

Recombinant Human SLC5A7, GST-tagged

Sign In for Pricing
View Details
PRIM1 AAV Vector (Human) (CMV)
37616101 1 µg

PRIM1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
MonoRab™ Anti-His Tag Antibody (22H1), mAb, Rabbit
A02343-100 100 µL

MonoRab™ Anti-His Tag Antibody (22H1), mAb, Rabbit

Sign In for Pricing
View Details
SPATA1 (m) -PR
sc-153710-PR 10 µM - 20 µL

SPATA1 (m) -PR

Sign In for Pricing
View Details