Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKR7A2 Peptide - N-terminal region

AKR7A2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AFAR, AKR7, AFAR1, AFB1-AR1

UniProt

O43488

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AKR7A2 Rabbit Polyclonal Antibody (orb327228) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003680

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX5 / BSAP (Early B-Cell Marker) (rPAX5/2060), CF740 conjugate, 0.1mg/mL
BNC742301-100 1x 100 µL

PAX5 / BSAP (Early B-Cell Marker) (rPAX5/2060), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human HAO2 activation kit by CRISPRa
GA109629 1 Kit

Human HAO2 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometriotic tissue
CS708169 5x 5 µm

Tissue FFPE Sections, Endometriotic tissue

Sign In for Pricing
View Details
Phospho-ATM (S1981) Recombinant Rabbit monoclonal Antibody [JM93-25]
ET1705-50-50UL 50 µL

Phospho-ATM (S1981) Recombinant Rabbit monoclonal Antibody [JM93-25]

Sign In for Pricing
View Details
PROX1 Human Gene Knockout Kit (CRISPR)
KN401140 1 Kit

PROX1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (57), CF488A conjugate, 0.1mg/mL
BNC880139-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (57), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details