AP1S2 Peptide - C-terminal region
AP1S2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
AP1S2, DC22
UniProt
P56377
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with AP1S2 Rabbit Polyclonal Antibody (orb331444) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb872043 100 µL
Creatine Kinase MM Rabbit Polyclonal Antibody (PE-Cy5)
Sign In for Pricing
View Details 