AP1S2 Peptide - C-terminal region
AP1S2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
AP1S2, DC22
UniProt
P56377
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with AP1S2 Rabbit Polyclonal Antibody (orb331444) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400646-100 1x 100 µL
Von Willebrand Factor (3E2D10 + VWF635), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040789-500 1x 500 µL
GFAP (ASTRO/789), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC473171-100 1x 100 µL
CD3e (T-Cell Marker) (C3e/3171R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC743785-100 1x 100 µL
Prolactin Receptor (hPRL Receptor) (PRLR/3785R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470031-100 1x 100 µL
Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880225-500 1x 500 µL
Major Vault Protein (MVP) (1032), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details