Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BICC1 Peptide - N-terminal region

BICC1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BICC1

UniProt

Q9H694

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BICC1 Rabbit Polyclonal Antibody (orb331445) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AAQSDPGSNSERSTDSPVPGSEDDLVAGATLHSPEWSEERFRVDRKKLEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRPR Polyclonal Antibody
E-AB-12444-01 20 µL

GRPR Polyclonal Antibody

Sign In for Pricing
View Details
GRPR Polyclonal Antibody
E-AB-12444-02 60 µL

GRPR Polyclonal Antibody

Sign In for Pricing
View Details
GRPR Polyclonal Antibody
E-AB-12444-03 120 µL

GRPR Polyclonal Antibody

Sign In for Pricing
View Details
GRPR Polyclonal Antibody
E-AB-12444-04 200 µL

GRPR Polyclonal Antibody

Sign In for Pricing
View Details
Propyl Paraben 4-Glucuronide-d7
TRC-P838362-25MG 25 mg

Propyl Paraben 4-Glucuronide-d7

Sign In for Pricing
View Details
PRP19 (PRPF19) (NM_014502) Human Over-expression Lysate
LC402343 20 µg

PRP19 (PRPF19) (NM_014502) Human Over-expression Lysate

Sign In for Pricing
View Details