Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BICC1 Peptide - N-terminal region

BICC1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BICC1

UniProt

Q9H694

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BICC1 Rabbit Polyclonal Antibody (orb331445) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AAQSDPGSNSERSTDSPVPGSEDDLVAGATLHSPEWSEERFRVDRKKLEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Breast
CS628888 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
EGFR pTyr1173 (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 9H2]
AM00042PU-N 100 µg

EGFR pTyr1173 (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 9H2]

Sign In for Pricing
View Details
2-Propenylfuran (>80%)
TRC-P709280-1G 1 g

2-Propenylfuran (>80%)

Sign In for Pricing
View Details
ASAM (CLMP) (NM_024769) Human Recombinant Protein
TP720361L 500 µg

ASAM (CLMP) (NM_024769) Human Recombinant Protein

Sign In for Pricing
View Details
Rabif Mouse Gene Knockout Kit (CRISPR)
KN514398 1 Kit

Rabif Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Disperse Orange 3 (Technical Grade)
TRC-D493485-1G 1 g

Disperse Orange 3 (Technical Grade)

Sign In for Pricing
View Details