Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNA6 Peptide - middle region

CHRNA6 Peptide - middle region

Product Specifications

Product Name Alternative

CHNRA6

UniProt

Q15825

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHRNA6 Rabbit Polyclonal Antibody (orb327233) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004189

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KFGSWTYDKAEIDLLIIGSKVDMNDFWENSEWEIIDASGYKHDIKYNCCE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ABCB11 Protein, N-His
YHB61301 100 μg

Recombinant Human ABCB11 Protein, N-His

Sign In for Pricing
View Details
Rabbit Polyclonal ATP2C2 Antibody [Janelia Fluor 549]
NBP1-76567JF549 0.1 mL

Rabbit Polyclonal ATP2C2 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
Growth Differentiation Factor 11 (GDF11) Magnetic Luminex Assay Kit
LKU602298 96 Tests

Growth Differentiation Factor 11 (GDF11) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
CD331/FGFR1 Mouse Monoclonal Antibody (PE)
orb2971062-01 50 Tests

CD331/FGFR1 Mouse Monoclonal Antibody (PE)

Sign In for Pricing
View Details
CD331/FGFR1 Mouse Monoclonal Antibody (PE)
orb2971062-02 100 Tests

CD331/FGFR1 Mouse Monoclonal Antibody (PE)

Sign In for Pricing
View Details
Human Anti-Hepatitis B core (anti-HBcAg) IgM ELISA kit, 96 tests, Quantitative
4565 1 Kit

Human Anti-Hepatitis B core (anti-HBcAg) IgM ELISA kit, 96 tests, Quantitative

Sign In for Pricing
View Details