Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHRNA6 Peptide - middle region

CHRNA6 Peptide - middle region

Product Specifications

Product Name Alternative

CHNRA6

UniProt

Q15825

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHRNA6 Rabbit Polyclonal Antibody (orb327233) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004189

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KFGSWTYDKAEIDLLIIGSKVDMNDFWENSEWEIIDASGYKHDIKYNCCE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Benzylamino-7-chloro-4-nitrobenzofurazan
sc-357020 100 mg

5-Benzylamino-7-chloro-4-nitrobenzofurazan

Sign In for Pricing
View Details
CCDC120 Human Over-expression Lysate
orb1359955 20 µg

CCDC120 Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Neisseria Gonorrhoeae nuoC Protein (aa 1-197) (strain ATCC 700825 / FA 1090)
VAng-Wyb2705-50gEcoli 50 µg (E. coli)

Recombinant Neisseria Gonorrhoeae nuoC Protein (aa 1-197) (strain ATCC 700825 / FA 1090)

Sign In for Pricing
View Details
MEL-1B-R Polyclonal Antibody
MBS2536400-01 0.02 mL

MEL-1B-R Polyclonal Antibody

Sign In for Pricing
View Details
MEL-1B-R Polyclonal Antibody
MBS2536400-02 0.06 mL

MEL-1B-R Polyclonal Antibody

Sign In for Pricing
View Details
MEL-1B-R Polyclonal Antibody
MBS2536400-03 0.12 mL

MEL-1B-R Polyclonal Antibody

Sign In for Pricing
View Details