Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CREM Peptide - C-terminal region

CREM Peptide - C-terminal region

Product Specifications

Product Name Alternative

CREM

UniProt

Q03060

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CREM Rabbit Polyclonal Antibody (orb331447) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LHSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Disks Large Homolog 1 (DLG1) ELISA Kit
abx510541-01 96 Tests

Mouse Disks Large Homolog 1 (DLG1) ELISA Kit

Sign In for Pricing
View Details
Mouse Disks Large Homolog 1 (DLG1) ELISA Kit
abx510541-02 5x 96 Tests

Mouse Disks Large Homolog 1 (DLG1) ELISA Kit

Sign In for Pricing
View Details
Mouse Disks Large Homolog 1 (DLG1) ELISA Kit
abx510541-03 10x 96 Tests

Mouse Disks Large Homolog 1 (DLG1) ELISA Kit

Sign In for Pricing
View Details
ZNF814-set siRNA/shRNA/RNAi Lentivector (Human)
51858091 4x 500 ng

ZNF814-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
BPIQ-II HCl Salt
sc-221375 1 mg

BPIQ-II HCl Salt

Sign In for Pricing
View Details
Mouse Tmem150c (NM_182841) AAV Particle
MR203168A1V 250 µL

Mouse Tmem150c (NM_182841) AAV Particle

Sign In for Pricing
View Details